Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_19246_iso_1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 153aa    MW: 17795.8 Da    PI: 7.0747
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                          HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                             Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                          +k +yps++e+  LA+ +gL+++q+ +WF N+R ++
  cra_locus_19246_iso_1_len_526_ver_3  79 YKWPYPSETEKVALAEATGLDQKQINNWFINQRKRH 114
                                          5679*****************************985 PP

                                  ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
  cra_locus_19246_iso_1_len_526_ver_3 34 ELKNHLLRKYSGYLSSLKQELS 55
                                         9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011883.5E-73455IPR005539ELK domain
PROSITE profilePS5121311.2963454IPR005539ELK domain
PfamPF037897.9E-113455IPR005539ELK domain
PROSITE profilePS5007112.81154117IPR001356Homeobox domain
SMARTSM003891.5E-1256121IPR001356Homeobox domain
CDDcd000865.83E-1266118No hitNo description
PfamPF059203.8E-1774113IPR008422Homeobox KN domain
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598348.14e-97PREDICTED: homeotic protein knotted-1 isoform X2
RefseqXP_016441623.14e-97PREDICTED: homeotic protein knotted-1-like isoform X2
RefseqXP_009598343.15e-97PREDICTED: homeotic protein knotted-1 isoform X1
RefseqXP_016441622.15e-97PREDICTED: homeotic protein knotted-1-like isoform X1
SwissprotQ413304e-98KN1_SOLLC; Homeotic protein knotted-1
TrEMBLI6LJ195e-97I6LJ19_9LAMI; Class 1 KNOX protein (Fragment)
TrEMBLV9LXK86e-97V9LXK8_TOBAC; Knotted 1
STRINGSolyc04g077210.2.19e-96(Solanum lycopersicum)
STRINGVIT_18s0001g08380.t012e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number